PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI05G15290.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 80aa    MW: 8738.08 Da    PI: 11.007
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI05G15290.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS34.92.1e-113875337374
             GRAS 337 aklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                       +++ +  + dg++v ee+g ++l+W+dr+L+svSaWr
  ORUFI05G15290.1  38 TRRVAQGLGCDGFKVREEKGNFFLCWQDRALFSVSAWR 75 
                      5677788899***************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF035147.2E-93875IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 80 aa     Download sequence    Send to blast
MAPLRGAKRR RKAAAEKKAA MAAAAVAEGP GGEGQLHTRR VAQGLGCDGF KVREEKGNFF  60
LCWQDRALFS VSAWRARCFD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2875403e-55AK287540.1 Oryza sativa Japonica Group cDNA, clone: J065011K01, full insert sequence.
GenBankAP0032593e-55AP003259.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0466H10.
GenBankAP0034583e-55AP003458.4 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0701E03.
GenBankAP0046873e-55AP004687.2 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0021C04.
GenBankAP0149573e-55AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAP0149623e-55AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015610769.15e-21PREDICTED: scarecrow-like protein 3 isoform X1
TrEMBLA0A0E0PLN32e-51A0A0E0PLN3_ORYRU; Uncharacterized protein
STRINGBGIOSGA005161-PA8e-21(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60438176
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.15e-14scarecrow-like 3